PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG622000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 853aa    MW: 93026.2 Da    PI: 5.9093
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG622000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS393.62.1e-1204768452374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL++cA+ v+++d + a++lL++++++asp+gd  qRla +f+++L+arla+++s++yk++ +++ +    +++l+a++l+  ++P+ 
  Pavir.5KG622000.1.p 476 ETLLIHCAQSVATDDRRGATELLKQIRQHASPNGDGDQRLAYCFANGLEARLAGNGSQIYKSVVMTRFP---CTDVLKAYQLYLAACPFK 562
                          789*****************************************************************9...9***************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          k+sh+ aNq+I++ave++++vHi+D++i +G+QWp+L+q L++Rp+gpp+lRiTg++ p++g   +e++eetg+ L+++A++++vpfef+
  Pavir.5KG622000.1.p 563 KISHFFANQTIVNAVEKAKKVHIVDYGIYYGFQWPCLIQRLSTRPGGPPRLRITGIDTPQPGfrPAERIEETGRYLKDYAQTFNVPFEFQ 652
                          ****************************************************************************************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + + +r+e++++e+L+++++E l++n++++ ++l++esv  es+r+ vL+++++++P+++++   + ++n++ F+ rf eal +ysa+fd
  Pavir.5KG622000.1.p 653 A-IPSRFEAVKIEDLHIEKDELLIINCMFRFKTLMEESVVAESPRNMVLNTIRKMNPHMFIHGIMNGSYNAPFFVSRFREALFHYSAIFD 741
                          *.7*************************************************************************************** PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                          +le+++pr++e+r  +E +l+gre++nv++ceg er er et+++W+ r ++aGFk++p++++++k a+  +r +++d + ++e++++l+
  Pavir.5KG622000.1.p 742 MLETNIPRDNEQRLLIETALFGREAMNVISCEGLERMERPETYKQWQVRNQRAGFKQLPINQDIMKRAREKVRCYHKD-FIIDEDNKWLL 830
                          ****************************************************************************77.*********** PP

                 GRAS 360 lgWkdrpLvsvSaWr 374
                          +gWk+r L+++S W+
  Pavir.5KG622000.1.p 831 QGWKGRILMALSTWK 845
                          **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.793449826IPR005202Transcription factor GRAS
PfamPF035147.4E-118476845IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 853 aa     Download sequence    Send to blast
MVMDAGLHEP CALLPGSNKR DGHLPIYPQI APAANRFTAE DLESLLFLPH DGIAAAAGAG  60
GGYLNVAPTI VVPPASTYQA SPPRDAAAAG GGGVGVGGYL NVASTTVVPP APTNSGPPPG  120
DAEAAAAPAA AGQPDDSEAF SDIVLGYINR MLMAEDIDDK YDHYPDHSAL LAAEKPFLEI  180
LADQPASSGG SAVESPNGSS VTNSCNSLGS CSCGAAAADG FSALPTPALD LPSAAFLQPP  240
QLYQDLSPES GVVDAGGPWP YDPTEFYQLQ ANPVAEAVLS QSPSFASLNC SGIASSDGFE  300
SLLSSSGVMT DVGLTDFGVH SQQAMHFCRG VEEASKFLPD ESKLVIDLEK SASVASLVAN  360
VKEEKRFSEV KTEKDDVEAA IHRGKKHFYG DDLDAEEGRC SKHSAAAAID PDHLVRDMMD  420
KVLLCNGEMC SKGVRELREA LQHDVGKHSH GGHGKESGHG KGRGKKQPKK EVIDLETLLI  480
HCAQSVATDD RRGATELLKQ IRQHASPNGD GDQRLAYCFA NGLEARLAGN GSQIYKSVVM  540
TRFPCTDVLK AYQLYLAACP FKKISHFFAN QTIVNAVEKA KKVHIVDYGI YYGFQWPCLI  600
QRLSTRPGGP PRLRITGIDT PQPGFRPAER IEETGRYLKD YAQTFNVPFE FQAIPSRFEA  660
VKIEDLHIEK DELLIINCMF RFKTLMEESV VAESPRNMVL NTIRKMNPHM FIHGIMNGSY  720
NAPFFVSRFR EALFHYSAIF DMLETNIPRD NEQRLLIETA LFGREAMNVI SCEGLERMER  780
PETYKQWQVR NQRAGFKQLP INQDIMKRAR EKVRCYHKDF IIDEDNKWLL QGWKGRILMA  840
LSTWKPDHKS SQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-544798458375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.167330.0leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970541.10.0PREDICTED: scarecrow-like protein 9
TrEMBLK3XEB70.0K3XEB7_SETIT; Uncharacterized protein
STRINGSi000234m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125183137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-180GRAS family protein